Sequence 1: | NP_608833.1 | Gene: | morgue / 33648 | FlyBaseID: | FBgn0027609 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076266.1 | Gene: | ube2l3b / 321943 | ZFINID: | ZDB-GENE-030131-662 | Length: | 190 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 56/197 - (28%) |
---|---|---|---|
Similarity: | 81/197 - (41%) | Gaps: | 50/197 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 315 GGRGQDAQ-------EADPQLG--------------------DREPGNVMRN--NFLRGEANLLN 350
Fly 351 SYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVS 415
Fly 416 RHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHERERFEQLVRAWTW 480
Fly 481 KY 482 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
morgue | NP_608833.1 | DUF3664 | 92..190 | CDD:289191 | |
F-box-like | 234..275 | CDD:289689 | |||
UQ_con | 342..479 | CDD:278603 | 40/136 (29%) | ||
COG5078 | 355..485 | CDD:227410 | 39/128 (30%) | ||
ube2l3b | NP_001076266.1 | COG5078 | 44..186 | CDD:227410 | 47/161 (29%) |
UBCc | 46..185 | CDD:214562 | 47/159 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |