DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and UBE2L5

DIOPT Version :10

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001342176.1 Gene:UBE2L5 / 171222 HGNCID:13477 Length:154 Species:Homo sapiens


Alignment Length:148 Identity:48/148 - (32%)
Similarity:67/148 - (45%) Gaps:21/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 MRN--NFLRGEANLLNSYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMT 399
            |.|  |....|||||.                  ||..|: |...||..|.|.:.|.||..||..
Human    19 MENFRNIQVDEANLLT------------------WQGLIV-PDNPPYNKGAFRIEINFPAEYPFK 64

  Fly   400 PPTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIY 464
            ||.:.|.|||.|||:...|.|.:.:....||..|....:|:.|:.:|:.||..|..:..:|...|
Human    65 PPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEY 129

  Fly   465 EHERERFEQLVRAWTWKY 482
            .::|::|.:....:|.||
Human   130 SNDRKKFCKNAEEFTKKY 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 48/148 (32%)
UBE2L5NP_001342176.1 UBCc_UBE2L3 3..149 CDD:467421 48/148 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.