DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment morgue and UBE2C

DIOPT Version :9

Sequence 1:	NP_608833.1	Gene:	morgue / 33648	FlyBaseID:	FBgn0027609	Length:	491	Species:	Drosophila melanogaster
Sequence 2:	NP_008950.1	Gene:	UBE2C / 11065	HGNCID:	15937	Length:	179	Species:	Homo sapiens

Alignment Length:	141	Identity:	50/141 - (35%)
Similarity:	68/141 - (48%)	Gaps:	12/141 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   321 AQEADP--------QLGDREPGNVMR---NNFLRGEANLLNSYESEGISAIPLDRQNNYWQATIL 374
            :|..||        :.|....|...|   ...|:.|...|.....:||||.|.......|..||.
Human     3 SQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIH 67

  Fly   375 GPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKV 439
            |..|:.||..::.|.:.||..||...|||:|||...||||...|::.:||.:: .||...:|..:
Human    68 GAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKE-KWSALYDVRTI 131

  Fly   440 LLSVQSLLTDP 450
            |||:||||.:|
Human   132 LLSIQSLLGEP 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
morgue	NP_608833.1	DUF3664	92..190	CDD:289191
		F-box-like	234..275	CDD:289689
		UQ_con	342..479	CDD:278603	44/109 (40%)
		COG5078	355..485	CDD:227410	41/96 (43%)
UBE2C	NP_008950.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..31		6/27 (22%)
UBE2C	NP_008950.1	UQ_con	34..170	CDD:395127	44/110 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910