DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and UBE2E3

DIOPT Version :10

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_006348.1 Gene:UBE2E3 / 10477 HGNCID:12479 Length:207 Species:Homo sapiens


Alignment Length:192 Identity:72/192 - (37%)
Similarity:99/192 - (51%) Gaps:34/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 DAQEADP------QLGDREPGNVM--RNNFLRGE--ANLLNSYE--SEGISAIPLDRQNN----- 367
            ||.:.||      :..:|:|....  :|..|..:  |.|..|.:  .:.::.|.||...|     
Human    21 DADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGP 85

  Fly   368 ------YWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDVGIDIFQ 426
                  .|::||||||||.||||.|||.|.|...||..||.|.|.|:|.|.|::..|.:.:||.:
Human    86 KGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILK 150

  Fly   427 QHNWSLALNVAKVLLSVQSLLTDPYTEVC--MEPELGYI---YEHERERFEQLVRAWTWKYA 483
            . |||.||.::|||||:.|||||     |  .:|.:|.|   |...|...:::.|.||.:||
Human   151 D-NWSPALTISKVLLSICSLLTD-----CNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 64/167 (38%)
UBE2E3NP_006348.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 10/41 (24%)
UBCc_UBE2E 64..204 CDD:467413 59/145 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.