DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15432 and AT1G16810

DIOPT Version :10

Sequence 1:NP_608832.1 Gene:CG15432 / 33647 FlyBaseID:FBgn0031603 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_564006.1 Gene:AT1G16810 / 838252 AraportID:AT1G16810 Length:144 Species:Arabidopsis thaliana


Alignment Length:141 Identity:41/141 - (29%)
Similarity:70/141 - (49%) Gaps:34/141 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YACVAKGKLKLKNDS-DLK----KKKKKHKGKDKEKELQKAFVEQQIAESGATSS---------- 54
            |..|..||||||..: |:|    |||||||   :::|......:.::.|..:|.:          
plant     4 YDNVIGGKLKLKGKALDVKAGGVKKKKKHK---RQEEQALKITDHELIEGESTEALGKLIEGEEG 65

  Fly    55 ------SATSGYERK----------LTKAELASKKQQEKMRNKRIMDKAQTTHKERVEKFNEHLD 103
                  |..:..:.|          ||.||....:|::::..:::..:|..:|:.|:|.||::|.
plant    66 DEEMNRSEKASEDAKLQQQLDDDDHLTPAERRYIEQKQRLDVQKLAKEANKSHRNRIEDFNQYLA 130

  Fly   104 TLTEHFDIPKV 114
            .::||:|||||
plant   131 NMSEHYDIPKV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15432NP_608832.1 None
AT1G16810NP_564006.1 FAM32A 3..108 CDD:369948 27/106 (25%)

Return to query results.
Submit another query.