DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15432 and AT2G25720

DIOPT Version :9

Sequence 1:NP_001260026.1 Gene:CG15432 / 33647 FlyBaseID:FBgn0031603 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_565606.1 Gene:AT2G25720 / 817113 AraportID:AT2G25720 Length:117 Species:Arabidopsis thaliana


Alignment Length:83 Identity:25/83 - (30%)
Similarity:40/83 - (48%) Gaps:7/83 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDEYACVAKGKLKLKND-----SDLKKKKKKHKGKDKEKELQKAFVEQQIAESGATSSSATSGY 60
            |||.|..|..|:|..|..     ..::|||||.:.|:||| |.......:.|..|:...:|.:| 
plant     1 MSDPYERVNGGRLAFKGGDLATRKSIEKKKKKKQKKNKEK-LDGVEDGAKTAPDGSPPPAAAAG- 63

  Fly    61 ERKLTKAELASKKQQEKM 78
            :..:...:.|.||:.:.:
plant    64 DEDIYSIDAAKKKKYDDL 81



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13282
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.