DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15432 and Fam32a

DIOPT Version :9

Sequence 1:NP_001260026.1 Gene:CG15432 / 33647 FlyBaseID:FBgn0031603 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001121550.1 Gene:Fam32a / 498600 RGDID:1561287 Length:112 Species:Rattus norvegicus


Alignment Length:121 Identity:60/121 - (49%)
Similarity:72/121 - (59%) Gaps:15/121 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEYACVAKGKLKLKNDSDL--KKKKKKHKGKDKEKELQKAFVEQQIAESGATSSSATSGYER--- 62
            :.|..|.||.||||..::|  .|:|||.|.|||.|.|          |:..||........|   
  Rat     2 EAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKML----------EAMGTSKKNEEEKRRCLD 56

  Fly    63 KLTKAELASKKQQEKMRNKRIMDKAQTTHKERVEKFNEHLDTLTEHFDIPKVSWTK 118
            |.|.|:.|.:|.|||.:.:||:.||..|||:|||.||.||||||||:|||||||||
  Rat    57 KRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15432NP_001260026.1 None
Fam32aNP_001121550.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..56 14/42 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340723
Domainoid 1 1.000 67 1.000 Domainoid score I9585
eggNOG 1 0.900 - - E1_KOG3410
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4911
OMA 1 1.010 - - QHG54737
OrthoDB 1 1.010 - - D1603617at2759
OrthoFinder 1 1.000 - - FOG0005009
OrthoInspector 1 1.000 - - otm46425
orthoMCL 1 0.900 - - OOG6_101764
Panther 1 1.100 - - LDO PTHR13282
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5354
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.