DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15432 and fam32a

DIOPT Version :9

Sequence 1:NP_001260026.1 Gene:CG15432 / 33647 FlyBaseID:FBgn0031603 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001002203.1 Gene:fam32a / 431750 ZFINID:ZDB-GENE-040704-44 Length:109 Species:Danio rerio


Alignment Length:115 Identity:59/115 - (51%)
Similarity:71/115 - (61%) Gaps:8/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EYACVAKGKLKLKNDSDLKKKKKKHKGKDKEKELQKAFVEQQIAESGATSSSATSGYERKLTKAE 68
            ||..|.||.||||..|...|||||     |.||:::  :|:|:..| .........|..|.|.|:
Zfish     3 EYKSVQKGSLKLKGVSLPSKKKKK-----KNKEMKR--LEEQVLTS-ENEEGTKKAYVDKRTPAQ 59

  Fly    69 LASKKQQEKMRNKRIMDKAQTTHKERVEKFNEHLDTLTEHFDIPKVSWTK 118
            :|..|.|||.:.:||:.||..|||.|||.||.||||||||:|||||||||
Zfish    60 MAFDKIQEKRQMERILKKASKTHKRRVEDFNRHLDTLTEHYDIPKVSWTK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15432NP_001260026.1 None
fam32aNP_001002203.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580541
Domainoid 1 1.000 66 1.000 Domainoid score I9987
eggNOG 1 0.900 - - E1_KOG3410
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4987
OMA 1 1.010 - - QHG54737
OrthoDB 1 1.010 - - D1603617at2759
OrthoFinder 1 1.000 - - FOG0005009
OrthoInspector 1 1.000 - - oto38701
orthoMCL 1 0.900 - - OOG6_101764
Panther 1 1.100 - - LDO PTHR13282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1802
SonicParanoid 1 1.000 - - X5354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.