DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15432 and LOC365238

DIOPT Version :9

Sequence 1:NP_001260026.1 Gene:CG15432 / 33647 FlyBaseID:FBgn0031603 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001102383.1 Gene:LOC365238 / 365238 RGDID:1583796 Length:116 Species:Rattus norvegicus


Alignment Length:122 Identity:56/122 - (45%)
Similarity:73/122 - (59%) Gaps:18/122 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEYACVAKGKLKLKNDSDL-KKKKKKHKGKDKEKELQKAFVEQQIAESGATSSSATSGYER---- 62
            :.|..|.||.||||..::| ..|::|.|.|||.|.|:...:.::..|            |:    
  Rat     7 EAYEQVQKGPLKLKGVAELGVTKRRKKKDKDKAKMLETMGMRKKSEE------------EKQHCL 59

  Fly    63 -KLTKAELASKKQQEKMRNKRIMDKAQTTHKERVEKFNEHLDTLTEHFDIPKVSWTK 118
             |.|.|:.|.:|.|||.:.:||:.||..|||:|||.||.||||||||:|||||||||
  Rat    60 DKRTPAQAAFEKMQEKRQTERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 116



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340724
Domainoid 1 1.000 67 1.000 Domainoid score I9585
eggNOG 1 0.900 - - E1_KOG3410
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4911
OMA 1 1.010 - - QHG54737
OrthoDB 1 1.010 - - D1603617at2759
OrthoFinder 1 1.000 - - FOG0005009
OrthoInspector 1 1.000 - - otm46425
orthoMCL 1 0.900 - - OOG6_101764
Panther 1 1.100 - - O PTHR13282
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5354
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.