DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15432 and fam32a

DIOPT Version :9

Sequence 1:NP_001260026.1 Gene:CG15432 / 33647 FlyBaseID:FBgn0031603 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001120136.1 Gene:fam32a / 100145169 XenbaseID:XB-GENE-966073 Length:112 Species:Xenopus tropicalis


Alignment Length:118 Identity:58/118 - (49%)
Similarity:70/118 - (59%) Gaps:11/118 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EYACVAKGKLKLKNDSDL---KKKKKKHKGKDKEKELQKAFVEQQIAESGATSSSATSGYERKLT 65
            ||....||.||||...|:   ||||||:|..|:        :.|:|..|.............|.|
 Frog     3 EYESAQKGALKLKGCGDMSLGKKKKKKNKANDQ--------IMQEIITSKKNEEEKKKPSLDKRT 59

  Fly    66 KAELASKKQQEKMRNKRIMDKAQTTHKERVEKFNEHLDTLTEHFDIPKVSWTK 118
            .|:||.:|.|||.:.:||:.||..|||:|||.||.||||||||:|||||||||
 Frog    60 PAQLAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15432NP_001260026.1 None
fam32aNP_001120136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..35 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9743
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4845
OMA 1 1.010 - - QHG54737
OrthoDB 1 1.010 - - D1603617at2759
OrthoFinder 1 1.000 - - FOG0005009
OrthoInspector 1 1.000 - - oto105538
Panther 1 1.100 - - LDO PTHR13282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1802
SonicParanoid 1 1.000 - - X5354
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.