DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dim1 and DIB1

DIOPT Version :9

Sequence 1:NP_608830.3 Gene:Dim1 / 33645 FlyBaseID:FBgn0031601 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_015407.1 Gene:DIB1 / 856197 SGDID:S000006286 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:138 Identity:91/138 - (65%)
Similarity:112/138 - (81%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYLVDITEV 66
            |.:||.|..||.|||||::|..|:||||||...|..||.|||::.||||:|:|||||||.||.||
Yeast     3 SVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEV 67

  Fly    67 PDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVYRGARKGRGLVV 131
            .||::||||.||.|||||:.|||:|.|.|||||||:|:.::||||||||:||::|||||.:||||
Yeast    68 SDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETIFRGARKNKGLVV 132

  Fly   132 SPKDYSTK 139
            ||.||:.|
Yeast   133 SPYDYNHK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dim1NP_608830.3 PLN00410 1..142 CDD:215109 91/138 (66%)
DIB1NP_015407.1 DIM1 5..137 CDD:397218 87/131 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345852
Domainoid 1 1.000 188 1.000 Domainoid score I653
eggNOG 1 0.900 - - E1_KOG3414
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7150
Inparanoid 1 1.050 191 1.000 Inparanoid score I907
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54232
OrthoFinder 1 1.000 - - FOG0005666
OrthoInspector 1 1.000 - - oto100334
orthoMCL 1 0.900 - - OOG6_102797
Panther 1 1.100 - - LDO PTHR12052
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5251
SonicParanoid 1 1.000 - - X4067
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.