DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dim1 and AT3G24730

DIOPT Version :9

Sequence 1:NP_608830.3 Gene:Dim1 / 33645 FlyBaseID:FBgn0031601 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_189117.2 Gene:AT3G24730 / 822071 AraportID:AT3G24730 Length:159 Species:Arabidopsis thaliana


Alignment Length:136 Identity:49/136 - (36%)
Similarity:76/136 - (55%) Gaps:4/136 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYLVDI-- 63
            |||:|..|....::|:.|....|.|:|:|||...|..|::.||::......|..||.:.|||:  
plant     9 MSYLLKTLTTKEEIDRVIRDTIDEVLVLRFGRSSDAVCLQHDEILAKSVRDVSKFAKVALVDVDS 73

  Fly    64 TEVPDFNKMYEL-YDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVYRGARKGR 127
            .:|..:.|.::: ..|.|: |||...|:.:|.||.::.|.......||:.||:||.:||||.||:
plant    74 EDVQVYVKYFDITLFPSTI-FFFNAHHMKLDSGTADHTKWVGAFHIKQDFIDVVEAIYRGAMKGK 137

  Fly   128 GLVVSP 133
            .:|..|
plant   138 MIVQCP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dim1NP_608830.3 PLN00410 1..142 CDD:215109 49/136 (36%)
AT3G24730NP_189117.2 DLP 18..133 CDD:239284 38/115 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54232
OrthoDB 1 1.010 - - D1320693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.