DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dim1 and txnl4a

DIOPT Version :9

Sequence 1:NP_608830.3 Gene:Dim1 / 33645 FlyBaseID:FBgn0031601 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001016646.1 Gene:txnl4a / 549400 XenbaseID:XB-GENE-1004157 Length:142 Species:Xenopus tropicalis


Alignment Length:142 Identity:137/142 - (96%)
Similarity:140/142 - (98%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYLVDITE 65
            |||||||||||||||||||||||||:||||||||||.|||||||:||||||||||||||||||||
 Frog     1 MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITE 65

  Fly    66 VPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVYRGARKGRGLV 130
            |||||||||||||||||||||||||||||||||||||||.:||||||||||||||||||||||||
 Frog    66 VPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIVETVYRGARKGRGLV 130

  Fly   131 VSPKDYSTKYRY 142
            ||||||||||||
 Frog   131 VSPKDYSTKYRY 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dim1NP_608830.3 PLN00410 1..142 CDD:215109 135/140 (96%)
txnl4aNP_001016646.1 PLN00410 1..142 CDD:215109 135/140 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 274 1.000 Domainoid score I1740
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H7150
Inparanoid 1 1.050 293 1.000 Inparanoid score I2721
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1320693at2759
OrthoFinder 1 1.000 - - FOG0005666
OrthoInspector 1 1.000 - - oto105465
Panther 1 1.100 - - LDO PTHR12052
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5251
SonicParanoid 1 1.000 - - X4067
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.