DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dim1 and Txnl4b

DIOPT Version :9

Sequence 1:NP_608830.3 Gene:Dim1 / 33645 FlyBaseID:FBgn0031601 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001013913.1 Gene:Txnl4b / 292008 RGDID:1305127 Length:149 Species:Rattus norvegicus


Alignment Length:136 Identity:53/136 - (38%)
Similarity:90/136 - (66%) Gaps:2/136 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYLVDITE 65
            ||::||.|.:..:|||||.|..::|:|:|||.|.||.|:::|:::...:..:...|.|||||:.:
  Rat     1 MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSADLSKMATIYLVDVDQ 65

  Fly    66 VPDFNKMYEL-YDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVYRGARKGRGL 129
            .|.:.:.::: |.|.|| |||..:|:.:|.|:.::.|.....:.||:.||::|.:||||.:|:.:
  Rat    66 TPVYTQYFDISYIPSTV-FFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLI 129

  Fly   130 VVSPKD 135
            |.||.|
  Rat   130 VQSPID 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dim1NP_608830.3 PLN00410 1..142 CDD:215109 53/136 (39%)
Txnl4bNP_001013913.1 DLP 10..123 CDD:239284 41/113 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6252
eggNOG 1 0.900 - - E1_KOG3414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4761
OMA 1 1.010 - - QHG54232
OrthoDB 1 1.010 - - D1320693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto98770
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.