DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dim1 and Txnl4a

DIOPT Version :9

Sequence 1:NP_608830.3 Gene:Dim1 / 33645 FlyBaseID:FBgn0031601 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001371102.1 Gene:Txnl4a / 27366 MGIID:1351613 Length:142 Species:Mus musculus


Alignment Length:142 Identity:136/142 - (95%)
Similarity:140/142 - (98%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYLVDITE 65
            ||||||||||||||||||||||||||||||||||||.|||||||:||||||||||||||||||||
Mouse     1 MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITE 65

  Fly    66 VPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVYRGARKGRGLV 130
            |||||||||||||||||||||||||||||||||||||||.:||||||:||:||||||||||||||
Mouse    66 VPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLV 130

  Fly   131 VSPKDYSTKYRY 142
            ||||||||||||
Mouse   131 VSPKDYSTKYRY 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dim1NP_608830.3 PLN00410 1..142 CDD:215109 134/140 (96%)
Txnl4aNP_001371102.1 PLN00410 1..142 CDD:215109 134/140 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848667
Domainoid 1 1.000 275 1.000 Domainoid score I1752
eggNOG 1 0.900 - - E1_KOG3414
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7150
Inparanoid 1 1.050 294 1.000 Inparanoid score I2742
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54232
OrthoDB 1 1.010 - - D1320693at2759
OrthoFinder 1 1.000 - - FOG0005666
OrthoInspector 1 1.000 - - oto95284
orthoMCL 1 0.900 - - OOG6_102797
Panther 1 1.100 - - LDO PTHR12052
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5251
SonicParanoid 1 1.000 - - X4067
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.