DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dim1 and dim1

DIOPT Version :9

Sequence 1:NP_608830.3 Gene:Dim1 / 33645 FlyBaseID:FBgn0031601 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_587992.1 Gene:dim1 / 2539369 PomBaseID:SPCC16A11.05c Length:142 Species:Schizosaccharomyces pombe


Alignment Length:142 Identity:113/142 - (79%)
Similarity:129/142 - (90%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYLVDITE 65
            |||.|||||:||.||||||||::|:||||||.|.|..|:|.|||:|.|||||.|.||||||||.|
pombe     1 MSYFLPHLHSGWHVDQAILSEQERLVVIRFGRDHDEECIKQDEVLYRIAEKVVNMAVIYLVDIDE 65

  Fly    66 VPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVYRGARKGRGLV 130
            ||||||||||||..|:|||:||||:|||||||||||||||||||||||||:||::||||||:|||
pombe    66 VPDFNKMYELYDRTTIMFFYRNKHMMIDLGTGNNNKINWPLEDKQEMIDIIETIFRGARKGKGLV 130

  Fly   131 VSPKDYSTKYRY 142
            :|||||||::||
pombe   131 ISPKDYSTRHRY 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dim1NP_608830.3 PLN00410 1..142 CDD:215109 111/140 (79%)
dim1NP_587992.1 DIM1 4..136 CDD:281031 104/131 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 232 1.000 Domainoid score I501
eggNOG 1 0.900 - - E1_KOG3414
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7150
Inparanoid 1 1.050 247 1.000 Inparanoid score I799
OMA 1 1.010 - - QHG54232
OrthoFinder 1 1.000 - - FOG0005666
OrthoInspector 1 1.000 - - oto102104
orthoMCL 1 0.900 - - OOG6_102797
Panther 1 1.100 - - LDO PTHR12052
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5251
SonicParanoid 1 1.000 - - X4067
TreeFam 1 0.960 - -
1312.950

Return to query results.
Submit another query.