DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dim1 and dib-1

DIOPT Version :9

Sequence 1:NP_608830.3 Gene:Dim1 / 33645 FlyBaseID:FBgn0031601 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001263740.1 Gene:dib-1 / 24105155 WormBaseID:WBGene00235102 Length:142 Species:Caenorhabditis elegans


Alignment Length:142 Identity:120/142 - (84%)
Similarity:133/142 - (93%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYLVDITE 65
            ||||||||.||||||||||:|||||||:||||||||.||:|||.::.||.|||||||:||||||:
 Worm     1 MSYMLPHLENGWQVDQAILAEEDRVVVVRFGHDWDPTCMQMDETLFKIAPKVKNFAVVYLVDITK 65

  Fly    66 VPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVYRGARKGRGLV 130
            |||||||||||||||.||||||||||:||||||||||||.:.|.||:|||:||||||||||||||
 Worm    66 VPDFNKMYELYDPCTAMFFFRNKHIMVDLGTGNNNKINWAVTDGQELIDIIETVYRGARKGRGLV 130

  Fly   131 VSPKDYSTKYRY 142
            :|||||||||:|
 Worm   131 ISPKDYSTKYKY 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dim1NP_608830.3 PLN00410 1..142 CDD:215109 119/140 (85%)
dib-1NP_001263740.1 PLN00410 1..142 CDD:215109 119/140 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165963
Domainoid 1 1.000 251 1.000 Domainoid score I1152
eggNOG 1 0.900 - - E1_KOG3414
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I1840
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54232
OrthoDB 1 1.010 - - D1320693at2759
OrthoFinder 1 1.000 - - FOG0005666
OrthoInspector 1 1.000 - - oto17462
orthoMCL 1 0.900 - - OOG6_102797
Panther 1 1.100 - - LDO PTHR12052
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4067
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.