DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dim1 and LOC100363110

DIOPT Version :9

Sequence 1:NP_608830.3 Gene:Dim1 / 33645 FlyBaseID:FBgn0031601 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_038959521.1 Gene:LOC100363110 / 100363110 RGDID:2324778 Length:144 Species:Rattus norvegicus


Alignment Length:145 Identity:99/145 - (68%)
Similarity:114/145 - (78%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAE---KVKNFAVIYLVD 62
            |.|:|||||||||||||||||||.||||.|.|||.|.|||||||:|.|||   |::.|...|:||
  Rat     1 MYYILPHLHNGWQVDQAILSEEDCVVVIHFRHDWGPTCMKMDEVLYIIAETKWKIRCFVNNYMVD 65

  Fly    63 ITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVYRGARKGR 127
            ..|||||||:.:|||.|:.|||||:|:.|:||||| ||||||.|||||.|.|::||:|..|.|.:
  Rat    66 FGEVPDFNKLAQLYDTCSTMFFFRSKYTMVDLGTG-NNKINWTLEDKQNMDDLIETIYHDACKDQ 129

  Fly   128 GLVVSPKDYSTKYRY 142
            .||.|.|||||||||
  Rat   130 SLVASRKDYSTKYRY 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dim1NP_608830.3 PLN00410 1..142 CDD:215109 97/143 (68%)
LOC100363110XP_038959521.1 Thioredoxin_like 1..144 CDD:412351 97/143 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1320693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.