DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dim1 and acer1

DIOPT Version :10

Sequence 1:NP_608830.3 Gene:Dim1 / 33645 FlyBaseID:FBgn0031601 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001106432.1 Gene:acer1 / 100127603 XenbaseID:XB-GENE-991795 Length:264 Species:Xenopus tropicalis


Alignment Length:69 Identity:14/69 - (20%)
Similarity:29/69 - (42%) Gaps:12/69 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ACMKMDEVMYSIAEKVKNFAVIY-----LVDITEVPD------FNKMYELYDPCTVMFFFRNKHI 90
            :|...|.:..|...:: ||..::     .:.||.|..      |:.|||:.:....:.::..|.:
 Frog   185 SCWLSDRLFCSFWRRI-NFCYLHSIWHVFICITVVYSNTLFAYFDAMYEIPESQPQVQYWPLKSL 248

  Fly    91 MIDL 94
            .:.|
 Frog   249 QVGL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dim1NP_608830.3 PLN00410 1..142 CDD:215109 14/69 (20%)
acer1NP_001106432.1 Ceramidase 7..256 CDD:461766 14/69 (20%)

Return to query results.
Submit another query.