DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and YIPF5

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001020118.1 Gene:YIPF5 / 81555 HGNCID:24877 Length:257 Species:Homo sapiens


Alignment Length:209 Identity:58/209 - (27%)
Similarity:88/209 - (42%) Gaps:45/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TTTATSASGVPEY--NTLDEPIRETVLRDIRAVGIKFYH-------VLYPKE--KSSLLRDWDLW 81
            |...|.||..|.|  |..|||   .:|.::   ||.|.|       ||:|.:  ..|::.:.||.
Human    70 TQAYTPASPQPFYGNNFEDEP---PLLEEL---GINFDHIWQKTLTVLHPLKVADGSIMNETDLA 128

  Fly    82 GPLVLC-TFMATILQGSSTADSMSDNGPEFAQVFVIVWIG--AAVVTLNSKLLGGNISFFQSVCV 143
            ||:|.| .|.||:|.....         :|..|:.|..||  .....||...:.| :||.....|
Human   129 GPMVFCLAFGATLLLAGKI---------QFGYVYGISAIGCLGMFCLLNLMSMTG-VSFGCVASV 183

  Fly   144 LGYCLTPVAISLIVCRVILLATQTRLLFFLR----FVTTTIGFAWATY-ASFVFLGQSQPPHRKP 203
            |||||.|          ::|.:...::|.|:    .:.|.....|.:: ||.:|:.......::.
Human   184 LGYCLLP----------MILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQL 238

  Fly   204 LAVYPIFLFFFIIS 217
            |..||..|.:.:.:
Human   239 LVAYPCALLYGVFA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 57/206 (28%)
YIPF5NP_001020118.1 Interaction with Sec23 75..106 13/36 (36%)
Yip1 <89..257 CDD:419731 50/190 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.