DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and Yipf4

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_080693.2 Gene:Yipf4 / 67864 MGIID:1915114 Length:246 Species:Mus musculus


Alignment Length:232 Identity:65/232 - (28%)
Similarity:107/232 - (46%) Gaps:48/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EDVNTS---PSLEGDMSIPGK--RTTTATSASGVPEYNTL----------DEPIRETVLRDIRAV 58
            ||::.|   |.::.::.:.|.  :.:|||:......|..|          ::|:.|.:..|::.:
Mouse    26 EDLSGSIAAPDVKLNLGVSGDFIKESTATTFLRQRGYGWLLEVEDEDPEDNKPLLEELDIDLKDI 90

  Fly    59 GIKFYHVLYPKE----KSSLLRD-WDLWGPLVLCTFMATI-LQGSSTADSMSDNGPEFAQV--FV 115
            ..|...||.|..    ...::|| .|.||||.:..|.:.| |.|            :|..|  .:
Mouse    91 YYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYG------------QFRVVSWII 143

  Fly   116 IVWI-GAAVVTLNSKLLGGNISFFQSVCVLGYCLTPVAISLIVCRVILLATQTRLLFFLRFVTTT 179
            .:|| |:..:.|.:::|||.:::.|.:.|:||.|.|    |||...|||...:     ...|:|.
Mouse   144 TIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLP----LIVIAPILLVVGS-----FEMVSTL 199

  Fly   180 I---GFAWATYASFVFLGQSQPPHRKPLAVYPIFLFF 213
            |   |..||.|::...|...:...:|||.:|||||.:
Mouse   200 IKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLY 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 59/205 (29%)
Yipf4NP_080693.2 Yip1 <76..239 CDD:419731 55/182 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.