DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and yipf6

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001015932.1 Gene:yipf6 / 548686 XenbaseID:XB-GENE-1009736 Length:233 Species:Xenopus tropicalis


Alignment Length:209 Identity:120/209 - (57%)
Similarity:164/209 - (78%) Gaps:1/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SLEGDMSIPGKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYHVLYPKEKSSLLRDWDL 80
            |:.||:.:.|:.|....|.|...:.:|||||:::|::||::|||.||.||:|||:.::|||||||
 Frog    23 SISGDIPVEGEITVPMASTSQEDDLSTLDEPVKDTIMRDLKAVGNKFLHVMYPKKSTTLLRDWDL 87

  Fly    81 WGPLVLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVVTLNSKLLGGNISFFQSVCVLG 145
            |||||||..:|.:|||.: |||..|.||:||:||||:|.||.|:|||||||||.||||||:||||
 Frog    88 WGPLVLCVSLALMLQGGN-ADSKDDGGPQFAEVFVIIWFGAVVITLNSKLLGGTISFFQSLCVLG 151

  Fly   146 YCLTPVAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQSQPPHRKPLAVYPIF 210
            ||:.|:.::::|||::||.:.|...|.:|.|..|:.|||:|:||..||..||||:|:.|||||||
 Frog   152 YCILPLTVAMLVCRLVLLLSHTTASFIVRLVVVTVMFAWSTFASTAFLADSQPPNRRALAVYPIF 216

  Fly   211 LFFFIISWLVLSHN 224
            ||:|:|||:||:.|
 Frog   217 LFYFVISWMVLTFN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 112/189 (59%)
yipf6NP_001015932.1 Yip1 <50..227 CDD:389810 109/177 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 195 1.000 Domainoid score I3099
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15501
Inparanoid 1 1.050 269 1.000 Inparanoid score I2952
OMA 1 1.010 - - QHG54214
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004230
OrthoInspector 1 1.000 - - oto104534
Panther 1 1.100 - - LDO PTHR21236
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1889
SonicParanoid 1 1.000 - - X3490
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.