DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and yipf6

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001002096.1 Gene:yipf6 / 415186 ZFINID:ZDB-GENE-040625-76 Length:240 Species:Danio rerio


Alignment Length:220 Identity:115/220 - (52%)
Similarity:163/220 - (74%) Gaps:11/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKLDMFEDVNTSPSLEGDMSIPGKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYHVLY 67
            |.:.:.||:    .:|||:|:|      ..|.:...:::|||||:::|:|||:||||.||.||:|
Zfish    27 SDISISEDI----PVEGDISVP------VGSQNADNDFSTLDEPVKDTILRDLRAVGQKFVHVMY 81

  Fly    68 PKEKSSLLRDWDLWGPLVLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVVTLNSKLLG 132
            ||:.|:|||||||||||:||..:|.:|||.| |||..|..|:||:||||:|.|:.::||||||||
Zfish    82 PKKSSALLRDWDLWGPLLLCVTLALMLQGGS-ADSEEDGRPQFAEVFVIIWFGSVIITLNSKLLG 145

  Fly   133 GNISFFQSVCVLGYCLTPVAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQSQ 197
            |.||||||:||||||:.|:.:::||||::||.....:.|.:|.:..|..|:|:|:||..||..||
Zfish   146 GTISFFQSLCVLGYCILPLTVAMIVCRIVLLGGSGVVSFAVRLIVVTASFSWSTFASTAFLADSQ 210

  Fly   198 PPHRKPLAVYPIFLFFFIISWLVLS 222
            |.:||.|.|||:|||:|:|.|::|:
Zfish   211 PTNRKALVVYPVFLFYFVIGWMILT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 106/189 (56%)
yipf6NP_001002096.1 Yip1 <57..234 CDD:304430 104/177 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581898
Domainoid 1 1.000 188 1.000 Domainoid score I3254
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15501
Inparanoid 1 1.050 251 1.000 Inparanoid score I3213
OMA 1 1.010 - - QHG54214
OrthoDB 1 1.010 - - D1287193at2759
OrthoFinder 1 1.000 - - FOG0004230
OrthoInspector 1 1.000 - - oto39948
orthoMCL 1 0.900 - - OOG6_102338
Panther 1 1.100 - - LDO PTHR21236
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1889
SonicParanoid 1 1.000 - - X3490
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.