DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and yipf4

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_998056.1 Gene:yipf4 / 405827 ZFINID:ZDB-GENE-040426-2253 Length:237 Species:Danio rerio


Alignment Length:226 Identity:64/226 - (28%)
Similarity:97/226 - (42%) Gaps:51/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SPSLEGDMSIPGKRTTTATSASGVPEYNTLDE----------PIRETVLRDIRAVGIKFYHVLYP 68
            :|.:..:|.....|.|.||:......|..|.|          |:.|.:..|::.:..|...||.|
Zfish    27 APDITLNMGPESNRDTYATTFLRQRGYGWLLEVEEEESEDTKPLLEELDIDLKDIYYKIRCVLMP 91

  Fly    69 KE----KSSLLRD-WDLWGPL--VLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWI------G 120
            ..    ...::|| .|.||||  ||...|.:|                :.|..|:.||      |
Zfish    92 MPSLGFNRQVVRDNPDFWGPLAVVLLFSMISI----------------YGQFRVVSWIITIWIFG 140

  Fly   121 AAVVTLNSKLLGGNISFFQSVCVLGYCLTPVAISLIVCRVILLATQTRLLFFLRFVTTTI---GF 182
            :..:.|.:::|||.:|:.|.:.|:||.|.|    |||...:||     ::.....|:|.|   |.
Zfish   141 SLTIFLLARVLGGEVSYGQVLGVIGYSLLP----LIVIAPLLL-----VIGGFEVVSTLIKLFGV 196

  Fly   183 AWATYASFVFLGQSQPPHRKPLAVYPIFLFF 213
            .||.|::...|...:...:|||.:|||||.:
Zfish   197 FWAAYSAASLLVGDEFKTKKPLLIYPIFLLY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 60/209 (29%)
yipf4NP_998056.1 Yip1 <69..230 CDD:304430 55/184 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.