DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and yipf5

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_956589.1 Gene:yipf5 / 393265 ZFINID:ZDB-GENE-040426-1057 Length:257 Species:Danio rerio


Alignment Length:205 Identity:53/205 - (25%)
Similarity:88/205 - (42%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYHV-------LYPKEKS--SLLRDWDLWGPLV 85
            |.||:..:...:..|||   .:|.::   ||.|.|:       |:|.:.|  |::.:.||.||:|
Zfish    74 TPTSSQSMYSSSFEDEP---PLLEEL---GINFDHIWQKTLTALHPLKASDGSIMNETDLAGPMV 132

  Fly    86 LC-TFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVV--TLNSKLLGGNISFFQSVCVLGYC 147
            .| .|.||:|.....         :|..|:.|..||...:  .||...:.| :||.....|||||
Zfish   133 FCLAFGATLLLTGKI---------QFGYVYGISAIGCLGMYSLLNLMSMTG-VSFGCVASVLGYC 187

  Fly   148 LTPVAISLIVCRVILLATQTRLLFFLR----FVTTTIGFAWATY-ASFVFLGQSQPPHRKPLAVY 207
            |.|          :::.:...::|.|:    .:.|.....|.:. ||.:|:.......::.|..|
Zfish   188 LLP----------MIILSSFGVIFSLQGIMGIILTAAIIGWCSLSASKIFISALAMDGQQLLVAY 242

  Fly   208 PIFLFFFIIS 217
            |..|.:.:.:
Zfish   243 PCALLYGVFA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 52/204 (25%)
yipf5NP_956589.1 Yip1 <89..257 CDD:304430 49/190 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.