DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and Yipf6

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001020918.1 Gene:Yipf6 / 363476 RGDID:1566154 Length:236 Species:Rattus norvegicus


Alignment Length:216 Identity:113/216 - (52%)
Similarity:155/216 - (71%) Gaps:10/216 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DVNTSPS--LEGDMSIP-GKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYHVLYPKEK 71
            ||:.|..  :||:::|| |.|.....|       :||:|.||.|::||::|||.||.|||||::.
  Rat    25 DVSISQDIPIEGEITIPSGTRAQECDS-------STLNESIRRTIMRDLKAVGRKFMHVLYPRKS 82

  Fly    72 SSLLRDWDLWGPLVLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVVTLNSKLLGGNIS 136
            ::|||||||||||:||..:|.:||.||.........||||:||||:|.||..:||||||||||||
  Rat    83 NTLLRDWDLWGPLILCVSLALMLQKSSVEGKRDGGSPEFAEVFVIIWFGAVTITLNSKLLGGNIS 147

  Fly   137 FFQSVCVLGYCLTPVAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQSQPPHR 201
            ||||:||||||:.|:.|::::||::|||.|..:.|.:|.....:.|||:..||..||...|||:|
  Rat   148 FFQSLCVLGYCVLPLNIAMLICRLLLLAGQGPINFMIRLFVVLVMFAWSVIASTAFLADCQPPNR 212

  Fly   202 KPLAVYPIFLFFFIISWLVLS 222
            |.|||||:|||:|::||::|:
  Rat   213 KALAVYPVFLFYFVVSWMILT 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 103/189 (54%)
Yipf6NP_001020918.1 Yip1 2..232 CDD:419731 112/213 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341867
Domainoid 1 1.000 179 1.000 Domainoid score I3439
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15501
Inparanoid 1 1.050 240 1.000 Inparanoid score I3266
OMA 1 1.010 - - QHG54214
OrthoDB 1 1.010 - - D1287193at2759
OrthoFinder 1 1.000 - - FOG0004230
OrthoInspector 1 1.000 - - oto97841
orthoMCL 1 0.900 - - OOG6_102338
Panther 1 1.100 - - LDO PTHR21236
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3490
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.