DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and YIPF6

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_776195.2 Gene:YIPF6 / 286451 HGNCID:28304 Length:236 Species:Homo sapiens


Alignment Length:222 Identity:113/222 - (50%)
Similarity:163/222 - (73%) Gaps:15/222 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKLDMFEDVNTSPSLEGDMSIPGKRTTTATSASGVPEY--NTLDEPIRETVLRDIRAVGIKFYHV 65
            |.:.:.:|:    .:||:::||.:        |.:.|:  :||:|.:|.|::||::|||.||.||
Human    24 SDISISQDI----PVEGEITIPMR--------SRIREFDSSTLNESVRNTIMRDLKAVGKKFMHV 76

  Fly    66 LYPKEKSSLLRDWDLWGPLVLCTFMATILQGSSTADSMSDNGPEFAQVFVIVWIGAAVVTLNSKL 130
            |||::.::|||||||||||:||..:|.:||..| |||..|.||:||:||||||.||..:||||||
Human    77 LYPRKSNTLLRDWDLWGPLILCVTLALMLQRDS-ADSEKDGGPQFAEVFVIVWFGAVTITLNSKL 140

  Fly   131 LGGNISFFQSVCVLGYCLTPVAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQ 195
            ||||||||||:||||||:.|:.:::::||::|||....:.|.:|.....:.|||:..||..||..
Human   141 LGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVNFMVRLFVVIVMFAWSIVASTAFLAD 205

  Fly   196 SQPPHRKPLAVYPIFLFFFIISWLVLS 222
            ||||:|:.|||||:|||:|:|||::|:
Human   206 SQPPNRRALAVYPVFLFYFVISWMILT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 106/191 (55%)
YIPF6NP_776195.2 Yip1 <54..231 CDD:389810 103/177 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147995
Domainoid 1 1.000 183 1.000 Domainoid score I3449
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15501
Inparanoid 1 1.050 242 1.000 Inparanoid score I3335
Isobase 1 0.950 - 0 Normalized mean entropy S1968
OMA 1 1.010 - - QHG54214
OrthoDB 1 1.010 - - D1287193at2759
OrthoFinder 1 1.000 - - FOG0004230
OrthoInspector 1 1.000 - - oto90738
orthoMCL 1 0.900 - - OOG6_102338
Panther 1 1.100 - - LDO PTHR21236
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1889
SonicParanoid 1 1.000 - - X3490
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.