DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and T08D2.6

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001380088.1 Gene:T08D2.6 / 188284 WormBaseID:WBGene00011611 Length:69 Species:Caenorhabditis elegans


Alignment Length:46 Identity:12/46 - (26%)
Similarity:22/46 - (47%) Gaps:7/46 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EYNTLDE---PIRETVLRDIRAVGIKFYHVLYP----KEKSSLLRD 77
            |.|..|.   |:.|.:..|:..:..|...||:|    :.|.:::|:
 Worm    19 EVNEEDSDQIPLLEELDIDLTDIYYKIRCVLHPLPYFRMKLNIVRE 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 12/46 (26%)
T08D2.6NP_001380088.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.