DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3652 and Y60A3A.19

DIOPT Version :9

Sequence 1:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001123056.1 Gene:Y60A3A.19 / 180305 WormBaseID:WBGene00013365 Length:255 Species:Caenorhabditis elegans


Alignment Length:247 Identity:64/247 - (25%)
Similarity:104/247 - (42%) Gaps:60/247 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKLDMFEDVNTS---------PSLEGDMSIPGKRTTTATSA------SG---VPEYNTLDE---P 46
            |..:.||..:.|         .|..|.:|....|.|.|.:|      ||   :.|.|..|.   |
 Worm    23 SNFEQFEHPDQSSNAPNSGSISSPTGQISAQAYRRTNAGAAGKFMENSGFGWLLEVNEEDSDQIP 87

  Fly    47 IRETVLRDIRAVGIKFYHVLYP----KEKSSLLRDW-DLWGPL-VLCTFMATILQGSSTADSMSD 105
            :.|.:..|:..:..|...||.|    :.|.:::|:. |.|||| |:..|....|.|         
 Worm    88 LLEELDIDLTDIYYKIRCVLLPLPYFRMKLNIVRESPDFWGPLAVVLAFAILSLYG--------- 143

  Fly   106 NGPEFAQVFVIVWI------GAAVVTLNSKLLGGNISFFQSVCVLGYCLTPVAISLIVCRVILLA 164
                  |..|:.||      |..:|...::.|||::.:.|.:.::||||.|:.::.::       
 Worm   144 ------QFGVVSWIITIWFCGGFMVYFIARALGGDVGYSQVLGIVGYCLIPLVVTSLI------- 195

  Fly   165 TQTRLLFFLRFVTTTIGF---AWATYASFVFLGQSQPPHRKPLAVYPIFLFF 213
              |.|....|.::..:|.   .|:.|::...|...:...:|||.|||:||.:
 Worm   196 --TPLFSSFRLLSNGLGMFGTIWSVYSAGTLLCVDELQAKKPLVVYPVFLLY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 55/210 (26%)
Y60A3A.19NP_001123056.1 Yip1 73..249 CDD:304430 51/197 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.