DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tps1 and CG5177

DIOPT Version :9

Sequence 1:NP_608827.1 Gene:Tps1 / 33642 FlyBaseID:FBgn0027560 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_001260191.1 Gene:CG5177 / 34017 FlyBaseID:FBgn0031908 Length:276 Species:Drosophila melanogaster


Alignment Length:263 Identity:99/263 - (37%)
Similarity:161/263 - (61%) Gaps:6/263 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 DDYLLKYIGY----NHKLALLLDYDGTLAPIAPHPDLATLSPEIKNVLYKLSNHSDVYVAVISGR 578
            :||:....|:    ..::||||||||||||:.  .:|:.:..:.:..:.||:.:..:::.|.|||
  Fly    14 EDYVKALEGFINPETDQVALLLDYDGTLAPLT--EELSVMPKDTEINIKKLAANEKIFMVVFSGR 76

  Fly   579 NVDNVKKMVGIEGITYAGNHGLEILHPDGSKFVHPMPMEYEKKVSDLLKALQDSVCRDGAWVENK 643
            .:..:|..:....:|||||||||:.:|.|.||...||.|..:|.:.|:..|::.|...|||||:|
  Fly    77 ELSEIKNHLKFPNVTYAGNHGLEVEYPSGKKFKIEMPEELLEKHNKLVSELKEKVVCSGAWVEDK 141

  Fly   644 GALLTFHYRETPNHLRGAMVDKARSLIEKYGFKATEAHCALEARPPVQWNKGRASIYILRTSFGV 708
            ...:|:||:...:.|:..::.:|:.||:.:||:..|...|||.:|.|.|:||..:..||...|..
  Fly   142 KISVTYHYKGVTDKLKAKLIAEAKGLIQAHGFQLIETPYALEGKPRVNWDKGEGAKMILEKQFDA 206

  Fly   709 DWNERIKIIYVGDDLTDEDAMVALKGMARTFRVTSSDIVKTAADHRLPSTDSVYTLLKWVERHFM 773
            ||.:.:||:|||||.|||||:..|.|:.:||||:....:||.|::::.:.:.|..|||.|:.::.
  Fly   207 DWAKNLKIVYVGDDTTDEDAIKVLHGIGKTFRVSELPTLKTYANYQIKTVEEVGYLLKAVQAYYE 271

  Fly   774 GRK 776
            .:|
  Fly   272 KKK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tps1NP_608827.1 GT1_TPS 19..495 CDD:99963
PRK14501 20..766 CDD:184712 95/251 (38%)
HAD_like 530..770 CDD:304363 95/239 (40%)
CG5177NP_001260191.1 HAD_like <5..259 CDD:304363 93/246 (38%)
HAD-SF-IIB 32..234 CDD:273651 83/203 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468836
Domainoid 1 1.000 110 1.000 Domainoid score I2101
eggNOG 1 0.900 - - E1_COG1877
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D76698at33208
OrthoFinder 1 1.000 - - FOG0000556
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X473
76.750

Return to query results.
Submit another query.