DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tps1 and AT4G27565

DIOPT Version :10

Sequence 1:NP_608827.1 Gene:Tps1 / 33642 FlyBaseID:FBgn0027560 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_001328875.1 Gene:AT4G27565 / 28720185 AraportID:AT4G27565 Length:122 Species:Arabidopsis thaliana


Alignment Length:30 Identity:10/30 - (33%)
Similarity:17/30 - (56%) Gaps:1/30 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PTAGLKS-EQVVSVNIDSKIFDSYYNGCCN 117
            |::|..| ::.||:.:...||..:.||..|
plant    82 PSSGSDSPKKFVSLYLFVTIFPLFPNGFIN 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tps1NP_608827.1 PRK14501 20..766 CDD:184712 10/30 (33%)
AT4G27565NP_001328875.1 PLN03063 <60..91 CDD:215555 3/8 (38%)

Return to query results.
Submit another query.