DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf2 and PSF2

DIOPT Version :9

Sequence 1:NP_001260022.1 Gene:Psf2 / 33641 FlyBaseID:FBgn0261976 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001319531.1 Gene:PSF2 / 820432 AraportID:AT3G12530 Length:210 Species:Arabidopsis thaliana


Alignment Length:181 Identity:63/181 - (34%)
Similarity:106/181 - (58%) Gaps:6/181 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PSIIEFIGEKCMISIIPNFSNEPLHLIYGPVGPFRAGFPVFVPLWMATHLRKQQKCRIVPPEWMD 67
            |..:||:.|..::.|:||.:.|.|:.|.|..|.|....|..||||:|..|:::.||...||.||.
plant    14 PQEVEFMAEDELVEIVPNMNMEQLNFISGDFGRFIPQIPTKVPLWLAVALKRRGKCTFRPPGWMS 78

  Fly    68 MDILEEIKEEEKRSK-FFTKMPCEHYMVVAQLVMSTAPDDVPRCEELRTVIKDIFDIRESKLRTS 131
            :|.|.:|.|.|:.|: .|..:|.. |:.:|:|:...|.||:|....:|::::||.|:|..||.|:
plant    79 VDNLTQILEAERESQSTFQALPFS-YVEIARLLFDHARDDIPDMYMVRSLVEDIRDVRLHKLETN 142

  Fly   132 IDAFIKGEGTYA-KLDNLTLLEIHSVRPILPYSLDHIARYQRTATASQRDT 181
            :.:|   :||.| |:.|::.:|::.|||.:..:|:...::.:......|||
plant   143 LGSF---QGTSAVKISNVSAMEVNIVRPFVIRALEAFYKHDKPEADVDRDT 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf2NP_001260022.1 GINS_B 2..63 CDD:425409 22/59 (37%)
GINS_A_psf2 55..174 CDD:212550 40/120 (33%)
PSF2NP_001319531.1 GINS_A_psf2 66..181 CDD:212550 40/118 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3211
eggNOG 1 0.900 - - E1_COG5093
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41105
Inparanoid 1 1.050 113 1.000 Inparanoid score I2051
OMA 1 1.010 - - QHG54349
OrthoDB 1 1.010 - - D1382842at2759
OrthoFinder 1 1.000 - - FOG0004322
OrthoInspector 1 1.000 - - oto3008
orthoMCL 1 0.900 - - OOG6_102798
Panther 1 1.100 - - LDO PTHR12772
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3593
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.