DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf2 and Gins2

DIOPT Version :9

Sequence 1:NP_001260022.1 Gene:Psf2 / 33641 FlyBaseID:FBgn0261976 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001099660.1 Gene:Gins2 / 292058 RGDID:1311055 Length:185 Species:Rattus norvegicus


Alignment Length:182 Identity:79/182 - (43%)
Similarity:134/182 - (73%) Gaps:0/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDPSIIEFIGEKCMISIIPNFSNEPLHLIYGPVGPFRAGFPVFVPLWMATHLRKQQKCRIVPPEW 65
            ||.:.:||:.||.:::||||||.:.::||.|.:|||..|.||.||||:|.:|:::||||::||||
  Rat     1 MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVDVPLWLAINLKQRQKCRLLPPEW 65

  Fly    66 MDMDILEEIKEEEKRSKFFTKMPCEHYMVVAQLVMSTAPDDVPRCEELRTVIKDIFDIRESKLRT 130
            ||::.||::::||::.:.||.:|..|||.:.:|:::.|.|::|:.:.:||:|||::|.|.:|||.
  Rat    66 MDVEKLEQMRDEERKEETFTPVPSPHYMEITKLLLNHASDNIPKADTIRTLIKDLWDTRMAKLRV 130

  Fly   131 SIDAFIKGEGTYAKLDNLTLLEIHSVRPILPYSLDHIARYQRTATASQRDTS 182
            |.|:|::.:..:||||||||:||::....|..:|:|:.:.:.....|:...|
  Rat   131 SADSFVRQQEAHAKLDNLTLMEINTSGAFLTQALNHMYKLRTNLQPSESSQS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf2NP_001260022.1 GINS_B 2..63 CDD:425409 30/60 (50%)
GINS_A_psf2 55..174 CDD:212550 50/118 (42%)
Gins2NP_001099660.1 GINS_B_Psf2 2..63 CDD:412030 30/60 (50%)
GINS_A_psf2 55..174 CDD:212550 50/118 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345462
Domainoid 1 1.000 131 1.000 Domainoid score I5040
eggNOG 1 0.900 - - E1_COG5093
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41105
Inparanoid 1 1.050 181 1.000 Inparanoid score I3888
OMA 1 1.010 - - QHG54349
OrthoDB 1 1.010 - - D1382842at2759
OrthoFinder 1 1.000 - - FOG0004322
OrthoInspector 1 1.000 - - oto95916
orthoMCL 1 0.900 - - OOG6_102798
Panther 1 1.100 - - LDO PTHR12772
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3593
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.