DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17612 and STP3

DIOPT Version :9

Sequence 1:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_013479.3 Gene:STP3 / 851089 SGDID:S000004367 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:50/222 - (22%)
Similarity:90/222 - (40%) Gaps:39/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 AHIRTHNETRTTEPPRLK-CPMCPSIYMKRGCLEAHMWIHRASDERESELEPPYRCPHCPKLFLY 368
            |.:.|.:.|:..:|.:.| ||:|.:.|..   |..|...|...::|      |::||.|.:.|..
Yeast   125 AGVSTPHSTKINKPRKKKQCPICRNFYAN---LTTHKATHLTPEDR------PHKCPICHRGFAR 180

  Fly   369 SSFLEIHIQTH--EDVSQRLSRKSSHKCAQCADV----------FSDVSSLKDHVK---IHAGER 418
            ::.|..|.:.|  :::..:....|:|...:...|          .:.::|:.|:.:   :|..:.
Yeast   181 NNDLLRHKKRHWKDEILSQSGVLSNHNDGKGGSVSPNDDDTHEKMTPMNSVTDYAQLKSLHQIKG 245

  Fly   419 TFKCPLCLMSFQEESNLKSHDCAHTRFK---CH------KCSKFFESQNYLDFHF----KKSHTT 470
            |||||......|.:.::..:......|:   ||      :|..|......|.|.:    ||....
Yeast   246 TFKCPFNSTLIQLDMDMYPYKLKPLNFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRN 310

  Fly   471 KGPFKCIKCQQTFQKRN-GLKEHISSQ 496
            ..|.:|..|...|:..: .|.||:..|
Yeast   311 VVPGRCKHCGLKFENVDVWLNEHVGKQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071
C2H2 Zn finger 290..310 CDD:275368 1/4 (25%)
C2H2 Zn finger 323..343 CDD:275370 6/19 (32%)
zf-C2H2_8 356..438 CDD:292531 20/96 (21%)
C2H2 Zn finger 359..379 CDD:275368 6/19 (32%)
C2H2 Zn finger 394..414 CDD:275368 3/32 (9%)
C2H2 Zn finger 422..438 CDD:275368 3/15 (20%)
C2H2 Zn finger 447..463 CDD:275368 5/21 (24%)
C2H2 Zn finger 476..505 CDD:275368 7/22 (32%)
C2H2 Zn finger 513..533 CDD:275368
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 568..584 CDD:275368
STP3NP_013479.3 COG5048 <137..295 CDD:227381 35/166 (21%)
C2H2 Zn finger 144..161 CDD:275368 6/19 (32%)
C2H2 Zn finger 171..191 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.