DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17612 and CG14710

DIOPT Version :9

Sequence 1:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:495 Identity:97/495 - (19%)
Similarity:170/495 - (34%) Gaps:146/495 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CCKVRPGLSVKRGGSLPKTLCLQCLHMDTFGTKHKGPRPETQINDKVHLEMSINGEDGLPEHPLY 71
            ||::|    |::...||:..|..|..........:    :..:|.:|:.|.|.:      |.|  
  Fly    41 CCRIR----VRQSPQLPEKACNSCCEFVQMWFNFR----QMCLNSQVYWETSSS------ERP-- 89

  Fly    72 PEVQLVVKEEDALIKKKVIEENHIHNEEIIGASNIVDVEVHENHRANNDVILIQDSFAEEVILED 136
               :.:.:..||.....:.|..|:.    :|..|....|:......:..    |:..::||:   
  Fly    90 ---EALAQASDAEYMLYLYENLHLK----LGTENQEKEEITAIEEGDEQ----QEDQSQEVL--- 140

  Fly   137 HPANNDVIIIQDSVAEEELPVIKEEAIEGEDLQGEYFIITECLEEPAIGSCRVCLEQSDNLTNIF 201
               :.:..||.:|:.|:|.|                  .||..|:..|          .::.:..
  Fly   141 ---DFNGFIINESIEEDEEP------------------NTESPEQILI----------SHMDSYV 174

  Fly   202 DDAHQYGIPIATILSQYTGMPVEKGDSFSEYICVTCLDVVKNAFDDLESKENTIQMYRQPKEEII 266
            ||            .|...:..:||:...|....       |.|.::|..:..:.|...|.    
  Fly   175 DD------------QQMEELIDDKGELVEELSNA-------NTFYEVEYGDEELLMSSAPS---- 216

  Fly   267 DIDSIPVKNKPVDYEVTGKPPHRCPQCPKIFL---LAAKLQAHIRTHNETRTTEPPRLKCPMCPS 328
                 |..:..:|.:..|:|  |.|.....|.   :.||.:.     |:.:..|..:..|.:|.:
  Fly   217 -----PHPSFKMDKQKPGRP--RKPDAELKFKRKDINAKERG-----NQPKCKEEEKFMCILCGN 269

  Fly   329 IYMKRGCLEAHMWIHRASDERESELEPPYRCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHK 393
            ::.|:....|||..|       ||.:|                                    |:
  Fly   270 VFYKKSVFTAHMMTH-------SEYKP------------------------------------HQ 291

  Fly   394 CAQCADVFSDVSSLKDHVKIHAGERTFKCPLCLMSFQEESNLKSHDCAHTR---FKCHKCSKFFE 455
            |..|...|..:..|:.|::.|.|:|.:||..|...|.:.|....|:..||.   :.|.:|.|.|.
  Fly   292 CEICNKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFT 356

  Fly   456 SQNYLDFHFKKSHTTKGPFKCIKCQQTFQKRNGLKEHISS 495
            ....|..|. .||:.:..:.|..|.::|...:.||.|:.:
  Fly   357 HTAILKNHI-LSHSAQKNYNCGICCKSFTLLHQLKAHLQT 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 7/58 (12%)
C2H2 Zn finger 290..310 CDD:275368 4/22 (18%)
C2H2 Zn finger 323..343 CDD:275370 6/19 (32%)
zf-C2H2_8 356..438 CDD:292531 14/81 (17%)
C2H2 Zn finger 359..379 CDD:275368 0/19 (0%)
C2H2 Zn finger 394..414 CDD:275368 5/19 (26%)
C2H2 Zn finger 422..438 CDD:275368 4/15 (27%)
C2H2 Zn finger 447..463 CDD:275368 5/15 (33%)
C2H2 Zn finger 476..505 CDD:275368 6/20 (30%)
C2H2 Zn finger 513..533 CDD:275368
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 568..584 CDD:275368
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 10/49 (20%)
COG5048 <261..395 CDD:227381 41/177 (23%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 6/21 (29%)
C2H2 Zn finger 292..312 CDD:275368 5/19 (26%)
zf-H2C2_2 304..327 CDD:290200 8/22 (36%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
zf-H2C2_2 335..357 CDD:290200 7/21 (33%)
C2H2 Zn finger 348..368 CDD:275368 6/20 (30%)
C2H2 Zn finger 376..395 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.