DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17612 and CG2678

DIOPT Version :9

Sequence 1:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster


Alignment Length:469 Identity:115/469 - (24%)
Similarity:175/469 - (37%) Gaps:126/469 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 CRVCLEQSDNLTNIFDDAH-----QYGIPIATILSQYTGMPVEKGDSFSEYICVTCLDVVKNAFD 246
            ||.|::::..|.:||.:..     :..:.::.||::.|..||::||...::|||:|:..|:|||.
  Fly     9 CRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQNAFR 73

  Fly   247 DLESKENTIQMY-------------------RQPKEEII------------DIDSIPVKNKPVDY 280
            .....|.:.|.:                   ...|.:||            |...:....|| |.
  Fly    74 FKWQSEQSYQHFFRVLNQSGAPENQVHLAACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKP-DD 137

  Fly   281 EVTGKPPHRCPQCPKIFLLAAKLQ-AHIRTHNETRTTEPPRLKC------PMCPSIYMKRGCLEA 338
            :::.|.           .|.|||| .:|....|:.|..|.:..|      .|.|.        ||
  Fly   138 DLSQKQ-----------TLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPK--------EA 183

  Fly   339 HMWIHRASDERESELEPPYRCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSD 403
                 ..|.:...:.:..|.||||.|.|...:.|..||   .|:..|        |..|...:..
  Fly   184 -----TRSTKMICDADGYYNCPHCSKRFCSQTQLRTHI---TDLCNR--------CPYCPRTYMQ 232

  Fly   404 VSSLKDHVKIHAGERTFKCPLCLMSFQEESNLKSHDCAHTR---FKCHKCSKFFESQNYLDFHFK 465
            .|:||.|::.|..:...||..|..:|..:.:||.|...|..   ..|.:||..|.....|:.|.:
  Fly   233 KSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRR 297

  Fly   466 ---------KSHTTKGP-------FKCIKCQQTFQKRNGLKEHISSQVCVQFLRSKSPGQIFP-- 512
                     ||.:||.|       .:.:|.:.|....||        .|      ..|..:.|  
  Fly   298 EHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNG--------TC------SIPPMLKPKP 348

  Fly   513 -CPKCPKKFSIEDNYQMHHATHKKVKTVIERH--NCTQCKKSYQNKKLLTKHILSHN----RCVH 570
             |..|.||||.....:.|..||.:     :.|  .||.|.:.::.:|.|.:|...|.    ||..
  Fly   349 ICDICQKKFSSVYALKRHMLTHNR-----QHHLKKCTYCSEEFKTEKHLKRHERGHMGDLFRCEF 408

  Fly   571 CSMSFTSKYLLEQH 584
            ||:.|.....|.:|
  Fly   409 CSLVFVDVNYLRKH 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 20/63 (32%)
C2H2 Zn finger 290..310 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275370 5/25 (20%)
zf-C2H2_8 356..438 CDD:292531 25/81 (31%)
C2H2 Zn finger 359..379 CDD:275368 9/19 (47%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
C2H2 Zn finger 422..438 CDD:275368 5/15 (33%)
C2H2 Zn finger 447..463 CDD:275368 5/15 (33%)
C2H2 Zn finger 476..505 CDD:275368 5/28 (18%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
C2H2 Zn finger 545..565 CDD:275368 6/19 (32%)
C2H2 Zn finger 568..584 CDD:275368 5/15 (33%)
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 23/75 (31%)
COG5048 220..>284 CDD:227381 18/71 (25%)
C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
zf-C2H2 249..271 CDD:278523 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..427 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006715
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.