DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17612 and D19A

DIOPT Version :9

Sequence 1:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster


Alignment Length:622 Identity:131/622 - (21%)
Similarity:216/622 - (34%) Gaps:172/622 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ENVCQCCKVRPGLSVKRGGSLPKTLCLQC------LH---------------------------M 33
            :.:|.|    ..|||::....||.||..|      ||                           .
  Fly    36 KKLCFC----TSLSVEQNDGFPKNLCTLCYTKLNELHDFQKQCVDSVQKFQDLVASNVFACQSSF 96

  Fly    34 DTFGTKHKGPRPETQINDKVHLEMSINGEDGLPEHPLYPEVQLVVKEEDALIKKKVIEENHIHNE 98
            |.|.       |...:.|....|......|.|..|    :::|:..|||..   |::|  |:..|
  Fly    97 DVFD-------PNVAVQDYPAEEEDHVNYDPLLNH----KMELIENEEDVF---KMLE--HVDKE 145

  Fly    99 EIIGASNI-VDVEVHENHRANNDVILIQDSFAEEVILEDHPANNDVIIIQDSVAEEELPVIKEEA 162
                |..: .:.:|.|:...|..|.:..|..:    :|....|:..:..:.:.:::::|      
  Fly   146 ----AEEVEKEAKVEEDDGGNVSVKMFDDDSS----IESGNDNDHDLDFEPNSSDDDIP------ 196

  Fly   163 IEGEDLQGEYFIITECLEEPAIGSCRVCLEQSDNLTNIFDDAHQYGIPIATILSQYTGMP----- 222
                        :.:.:..||.||.    .|.|..:|:  |..:         .:..|.|     
  Fly   197 ------------LAQRMRGPATGSG----PQQDRFSNL--DKPK---------PRPRGRPKKIKP 234

  Fly   223 -----VEKGDSFSEYICVTCLDVVKNAFDDLESKENTIQMYRQPKEEIIDIDSIPVKNKPVDYEV 282
                 .|..||.||             .||   .|:......:||.:     .||::.:.:    
  Fly   235 PPPEEEELSDSSSE-------------SDD---SEDGTSRGDKPKRK-----RIPIEERHL---- 274

  Fly   283 TGKPPHR---CPQCPKIFLLAAKLQAHIRTHNETRTTEPPRLKCPMCPSIYMKRGCLEAHMWIHR 344
                 ||   |..|.:.|..|.:.:.|::.||:..   |.:.|...|...:.....|..|:    
  Fly   275 -----HRIIDCHICHQKFKKAIRYEEHMKYHNDLL---PFQCKVETCKKGFTTANGLRIHI---- 327

  Fly   345 ASDERESELEPPYRC--PHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSDVSSL 407
              |...:||...:.|  ..|.|.|.....|..|::....:::..:......|.:|..||...::|
  Fly   328 --DHAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGITKAAAPLRDFPCTECDTVFRCPTAL 390

  Fly   408 KDHVKIHAGER-TFKCPLCLMSFQEESNLKSHDCAHTRFK---CHKCSKFFESQNYLDFHFKKSH 468
            |.|:..|.||. .:.|.:|...|...|.|:.|...|...|   |..|.....::...:.|. .:|
  Fly   391 KKHMYKHTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYCGVGKTTRQEWNAHI-LTH 454

  Fly   469 TTKGPFKCIKCQQTFQKRNGLKEHISSQVCVQFLRSKSPGQIFPCPKCPKKFSIEDNYQMHHATH 533
            |.:..|||.:|......:..|..|      |:.:..|.  :.|.|..|.|.|......::|..:|
  Fly   455 TKEKKFKCRQCDHASHNKQALSNH------VKVVHEKR--KDFACQYCGKTFGKSHACKVHERSH 511

  Fly   534 KKVKTVIERHNCTQCK---KSYQNKKLLTKHILSHNR 567
            ...|       |.:||   |.:..:|.||||:.:|.:
  Fly   512 TGEK-------CCECKICGKIFLCEKSLTKHLKTHEK 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 11/68 (16%)
C2H2 Zn finger 290..310 CDD:275368 5/19 (26%)
C2H2 Zn finger 323..343 CDD:275370 3/19 (16%)
zf-C2H2_8 356..438 CDD:292531 21/84 (25%)
C2H2 Zn finger 359..379 CDD:275368 6/21 (29%)
C2H2 Zn finger 394..414 CDD:275368 7/19 (37%)
C2H2 Zn finger 422..438 CDD:275368 5/15 (33%)
C2H2 Zn finger 447..463 CDD:275368 2/15 (13%)
C2H2 Zn finger 476..505 CDD:275368 5/28 (18%)
C2H2 Zn finger 513..533 CDD:275368 5/19 (26%)
C2H2 Zn finger 545..565 CDD:275368 9/22 (41%)
C2H2 Zn finger 568..584 CDD:275368 131/622 (21%)
D19ANP_477304.1 zf-AD 12..83 CDD:214871 12/50 (24%)
C2H2 Zn finger 343..362 CDD:275368 5/18 (28%)
C2H2 Zn finger 377..397 CDD:275368 7/19 (37%)
zf-H2C2_2 389..414 CDD:290200 8/24 (33%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..454 CDD:275368 3/20 (15%)
C2H2 Zn finger 462..483 CDD:275368 5/26 (19%)
C2H2 Zn finger 491..511 CDD:275368 5/19 (26%)
C2H2 Zn finger 519..539 CDD:275368 8/19 (42%)
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449790
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.