DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17612 and CG17385

DIOPT Version :9

Sequence 1:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster


Alignment Length:291 Identity:66/291 - (22%)
Similarity:107/291 - (36%) Gaps:74/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 VDYEVTGKPPHRCPQCPKIFLLAAKLQAHIR-THNETRTTEPPRLKCPMCPSIYMKRGCLEAHMW 341
            |:::.|......|.:|.:.|........|.: .||..:||                         
  Fly     6 VEFDETVANQFSCKRCDRTFRSKRDQTLHRQEVHNHNKTT------------------------- 45

  Fly   342 IHRASDERESELEPPYRCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSDVSS 406
                           |.|..|.|.|..|..|:.|::.|.||...:       |..|:..|:...:
  Fly    46 ---------------YECKLCAKSFCNSGNLDRHMKVHNDVRPFV-------CNICSKAFAQAVN 88

  Fly   407 LKDHVKIHAGERTFKCPLCLMSFQEESNLKSHDCAHT---RFKCHKCSKFFESQNYLDFHFKKSH 468
            |:.|..:|:|||.|.|..|..||.::||:|.|...||   .|:|.:|.::|.....|..| |..|
  Fly    89 LQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNLKKH-KLGH 152

  Fly   469 TTKGPFKCIKCQQTFQKRNGLKEHISSQV------------------CVQFLRSKSPGQIFPCPK 515
            ....|::|..|::.|.:.:..|.|:.|.:                  ..:.|.|:.....|.|..
  Fly   153 LNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGVDVDVPASIQAAAALARERLESEQKPSFFECMV 217

  Fly   516 CPKKFSIEDNYQMH----HATHKKVKTVIER 542
            |...|....:|:.|    |..|::.:..:.:
  Fly   218 CRAIFDTFADYEKHEAKCHEDHERAQLEVNQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071
C2H2 Zn finger 290..310 CDD:275368 4/20 (20%)
C2H2 Zn finger 323..343 CDD:275370 0/19 (0%)
zf-C2H2_8 356..438 CDD:292531 28/81 (35%)
C2H2 Zn finger 359..379 CDD:275368 7/19 (37%)
C2H2 Zn finger 394..414 CDD:275368 5/19 (26%)
C2H2 Zn finger 422..438 CDD:275368 7/15 (47%)
C2H2 Zn finger 447..463 CDD:275368 4/15 (27%)
C2H2 Zn finger 476..505 CDD:275368 7/46 (15%)
C2H2 Zn finger 513..533 CDD:275368 6/23 (26%)
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 568..584 CDD:275368
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 54/215 (25%)
C2H2 Zn finger 18..39 CDD:275368 4/20 (20%)
C2H2 Zn finger 48..68 CDD:275368 7/19 (37%)
C2H2 Zn finger 76..96 CDD:275368 5/19 (26%)
C2H2 Zn finger 104..124 CDD:275368 8/19 (42%)
C2H2 Zn finger 132..148 CDD:275368 4/15 (27%)
C2H2 Zn finger 160..180 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.