DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17612 and CG17568

DIOPT Version :9

Sequence 1:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:494 Identity:108/494 - (21%)
Similarity:189/494 - (38%) Gaps:117/494 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VDVEVHENHRANNDVIL---IQDSFAEEVILEDHPANNDVIIIQDSVAEEELPVIKEEAIEGEDL 168
            |.|:::||.:.|.|.:|   |:..|..::.|||..::  |:..:......||....|...:.:|:
  Fly    23 VKVQMNENSQGNWDNVLIMAIRKYFEVQMQLEDELSS--VLCTECYTLISELIDFAEHVTKVQDI 85

  Fly   169 ---------QGEYFIITECLEEPAIGSCRVCLEQSDNLTNIF----------DDAHQ------YG 208
                     .|:..:....|.: ..|.|      .|:.|:|.          |:.:|      ..
  Fly    86 FEVLRRTETDGDQEMDVAALRQ-QFGLC------DDDWTHIIKPIPALEMESDNVYQKPAELLKD 143

  Fly   209 IPIATILSQYTGMPVEKGDSFSEYICV---TCLDVVKNAFDDLES---KENTIQMYRQ------P 261
            .|:|...||  .|.:.|..:.:..|..   ..:::.|..|.||..   ::||.|:..:      |
  Fly   144 FPLAETSSQ--EMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPILLEKNTSQLDMEDVLDELP 206

  Fly   262 KEEI----IDIDSIP------VKNK------------PVDYEVTGKPPHRCPQCPKIFLLAAKLQ 304
            :||:    :|..:.|      ||::            |||.::                  ..|.
  Fly   207 QEELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQL------------------MDLV 253

  Fly   305 AHIRTHNETRTT-----EPPRLKCPMCPSIYMKRGCLEAHMWIHRASDERESELE-PPYRCPHCP 363
            |...|.|...:|     :..|:.|..|..:|..|...|.|:.......||..::: ....|..|.
  Fly   254 AVATTPNTLESTAEEKAKRGRMDCEKCGKVYRNRASYEKHLERECRRIERRVKVDKTTTTCDICN 318

  Fly   364 KLFLYSSFLEIHIQ-THEDVSQRLSRKSSHKCAQCADVFSDVSSLKDHVKIHAGERTFKCPLCLM 427
            |....::.|::|.: .|::|...:       |..|......:::|.:|..:|...|.|:|.:|..
  Fly   319 KTLSSATALKLHKEGIHQNVKPYI-------CDSCGKQLKTITALNEHKLVHTESRPFECTVCKA 376

  Fly   428 SFQEESNLKSHDCAHTR--FKCHKCSKFFESQNYLDFHFKKSHTTKGPFKCIKCQQTFQKRNGLK 490
            .|:..:.||:|...|..  |.|:.|.|..:::...:.| |..||.:...||..|...|::...||
  Fly   377 GFKNRARLKAHYQIHAEPSFVCNICGKKLQTRRTWNMH-KVVHTEERRLKCDVCGALFKRSKTLK 440

  Fly   491 EHISSQVCVQFLRSKSPGQIFPCPKCPKKFSIEDNYQMH 529
            .|:.|...::      |   :.|..|.|.|:...|.:.|
  Fly   441 THLLSHTGLR------P---YVCNYCGKSFACNANCRSH 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 14/77 (18%)
C2H2 Zn finger 290..310 CDD:275368 2/19 (11%)
C2H2 Zn finger 323..343 CDD:275370 6/19 (32%)
zf-C2H2_8 356..438 CDD:292531 19/82 (23%)
C2H2 Zn finger 359..379 CDD:275368 5/20 (25%)
C2H2 Zn finger 394..414 CDD:275368 4/19 (21%)
C2H2 Zn finger 422..438 CDD:275368 5/15 (33%)
C2H2 Zn finger 447..463 CDD:275368 3/15 (20%)
C2H2 Zn finger 476..505 CDD:275368 7/28 (25%)
C2H2 Zn finger 513..533 CDD:275368 6/17 (35%)
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 568..584 CDD:275368
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 17/65 (26%)
COG5048 <313..471 CDD:227381 44/175 (25%)
C2H2 Zn finger 314..335 CDD:275368 5/20 (25%)
C2H2 Zn finger 343..363 CDD:275368 4/19 (21%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
C2H2 Zn finger 398..418 CDD:275368 5/20 (25%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
zf-H2C2_2 439..463 CDD:290200 9/32 (28%)
C2H2 Zn finger 454..475 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.