Sequence 1: | NP_608824.1 | Gene: | CG17612 / 33639 | FlyBaseID: | FBgn0031597 | Length: | 618 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477466.1 | Gene: | Kr-h1 / 33861 | FlyBaseID: | FBgn0266450 | Length: | 845 | Species: | Drosophila melanogaster |
Alignment Length: | 223 | Identity: | 66/223 - (29%) |
---|---|---|---|
Similarity: | 98/223 - (43%) | Gaps: | 26/223 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 276 KPVDYEVTGKPPHRCPQCPKIFLLAAKLQAHIRTHNETRTTEPPRLKCPMCPSIYMKRGCLEAHM 340
Fly 341 WIHRASDERESELEPPYRCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSDVS 405
Fly 406 SLKDHVKIHAGERTFKCPL--CLMSFQEESNLKSHDCAHT---RFKCHKCSKFFESQNYLDFHFK 465
Fly 466 KSHTTKGPFKCIKCQQTFQKRNGLKEHI 493 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17612 | NP_608824.1 | zf-AD | 187..>246 | CDD:285071 | |
C2H2 Zn finger | 290..310 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 323..343 | CDD:275370 | 4/19 (21%) | ||
zf-C2H2_8 | 356..438 | CDD:292531 | 26/83 (31%) | ||
C2H2 Zn finger | 359..379 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 394..414 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 422..438 | CDD:275368 | 6/17 (35%) | ||
C2H2 Zn finger | 447..463 | CDD:275368 | 4/15 (27%) | ||
C2H2 Zn finger | 476..505 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 513..533 | CDD:275368 | |||
C2H2 Zn finger | 545..565 | CDD:275368 | |||
C2H2 Zn finger | 568..584 | CDD:275368 | |||
Kr-h1 | NP_477466.1 | C2H2 Zn finger | 196..216 | CDD:275368 | |
COG5048 | <270..420 | CDD:227381 | 52/169 (31%) | ||
zf-C2H2 | 271..293 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 286..309 | CDD:290200 | 10/27 (37%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 313..338 | CDD:290200 | 10/32 (31%) | ||
C2H2 Zn finger | 329..349 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 344..366 | CDD:290200 | 7/28 (25%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 370..396 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 385..407 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 400..424 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 415..435 | CDD:275368 | 5/20 (25%) | ||
zf-C2H2 | 441..463 | CDD:278523 | 7/20 (35%) | ||
C2H2 Zn finger | 443..463 | CDD:275368 | 6/18 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |