DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17612 and klu-2

DIOPT Version :9

Sequence 1:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_491843.3 Gene:klu-2 / 172339 WormBaseID:WBGene00022592 Length:386 Species:Caenorhabditis elegans


Alignment Length:193 Identity:43/193 - (22%)
Similarity:87/193 - (45%) Gaps:30/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 SSF--LEIHIQTHEDVSQRLSRKSSHKCAQCADVFSDVS----SLKDHVKIHAGER------TFK 421
            |:|  :..|.|:.|::.||:...:|...:...::.:.:|    :....|:..:|..      .:.
 Worm   184 SAFEIVSCHHQSAEEILQRVRLGTSGSTSSANNLRNSLSEATTTTTGSVESTSGTADGSAPGQYY 248

  Fly   422 CPLCLMSFQEESNLKSHDCAHT---RFKCHKCSKFFESQNYLDFHFKKSHTTKGPFKCIKCQQTF 483
            |.:|...|:....|..|...||   .|||..|.:||...::|..| :::||.:.|:.|..|..:.
 Worm   249 CFICEKDFRRPDILSRHTRRHTGEKPFKCEDCGRFFSRSDHLRTH-RRTHTDEKPYHCCVCNYSA 312

  Fly   484 QKRNGLKEHISSQVCVQFLRSKSPGQIFPCPKCPKKFSIEDNY---------QMHHATHKKVK 537
            ::|:.|..|:|::     .::.:|..|....:..::...:.:|         |.|.||.::|:
 Worm   313 RRRDVLTRHMSTR-----HQAIAPPSILGTHRNVRRCLSDGDYHKMAAQELRQRHQATREEVE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071
C2H2 Zn finger 290..310 CDD:275368
C2H2 Zn finger 323..343 CDD:275370
zf-C2H2_8 356..438 CDD:292531 15/80 (19%)
C2H2 Zn finger 359..379 CDD:275368 4/11 (36%)
C2H2 Zn finger 394..414 CDD:275368 2/23 (9%)
C2H2 Zn finger 422..438 CDD:275368 4/15 (27%)
C2H2 Zn finger 447..463 CDD:275368 5/15 (33%)
C2H2 Zn finger 476..505 CDD:275368 6/28 (21%)
C2H2 Zn finger 513..533 CDD:275368 4/28 (14%)
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 568..584 CDD:275368
klu-2NP_491843.3 COG5048 216..>298 CDD:227381 18/82 (22%)
C2H2 Zn finger 249..269 CDD:275368 5/19 (26%)
zf-H2C2_2 262..286 CDD:290200 10/23 (43%)
COG5048 273..>328 CDD:227381 17/60 (28%)
C2H2 Zn finger 277..297 CDD:275368 6/20 (30%)
zf-H2C2_2 289..314 CDD:290200 7/25 (28%)
C2H2 Zn finger 305..324 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.