DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf4 and AT3G58400

DIOPT Version :9

Sequence 1:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001319794.1 Gene:AT3G58400 / 825009 AraportID:AT3G58400 Length:293 Species:Arabidopsis thaliana


Alignment Length:95 Identity:22/95 - (23%)
Similarity:37/95 - (38%) Gaps:29/95 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 HVSVYIKV-----LPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNE 444
            ::|:|::|     ||      ..|......|.||..|.::       :||.|:...|.|.     
plant    45 YLSLYLEVADNGSLP------FGWRRHARYTLTLVNQNSK-------KSFQPNEVQEWFD----- 91

  Fly   445 PDQLGFGFPRFISHELLHSRPFIKGDTVFL 474
             |.:.:|.|.......:|::     |:.||
plant    92 -DSIKWGCPSMFPLNEIHAK-----DSGFL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635
zf-TRAF 233..292 CDD:424248
MATH_TRAF4 331..479 CDD:239750 22/95 (23%)
AT3G58400NP_001319794.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.