DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf4 and Traf1

DIOPT Version :9

Sequence 1:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001258169.1 Gene:Traf1 / 687813 RGDID:1596290 Length:409 Species:Rattus norvegicus


Alignment Length:367 Identity:95/367 - (25%)
Similarity:142/367 - (38%) Gaps:135/367 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 CPQRCDAG---PIPRGEL---EAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAH---------- 292
            || :|.|.   |:..|.|   |..|.|..:: .:.|.|...||.|||..|.::.|          
  Rat    48 CP-KCRADGLQPVSPGSLLTQEKVLPDVAEA-GIVCPFAGVGCSFKGSPQSVQEHEATSQSSHLY 110

  Fly   293 -----------------------LESN-------------------------------------- 296
                                   ||.|                                      
  Rat   111 LLLGVLKEWKSSPGPNLGSAPMALEQNLSELQLQEAVEVTGDLEVDCYRAPCCESQEELALQHLL 175

  Fly   297 --------------------------AAAHLSL--------------------MVALSSRQGQQI 315
                                      .|:||:|                    :|.|.....|:.
  Rat   176 KEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHVLNLEQRVVELQQTLAQKD 240

  Fly   316 QMLKSAVSKLSI----NYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLN 376
            |:|......|.:    ::.||.|||||:.:.:..|:.....:.|.||.|||::|||||...::||
  Rat   241 QVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLN 305

  Fly   377 GNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRP 441
            |:|.|:.||:|::|.::.|||||||.|||.:.:||.|.:   |:.:....::|.||.:..:||||
  Rat   306 GDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLD---QNNREHAIDAFRPDLSSASFQRP 367

  Fly   442 SNEPDQLGFGFPRFISHELLHS--RPFIKGDTVFLRVKVDPS 481
            .:|.: :..|.|.|.....|.|  ..::|.||:||:..||.|
  Rat   368 QSETN-VASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVDTS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635
zf-TRAF 233..292 CDD:424248 18/53 (34%)
MATH_TRAF4 331..479 CDD:239750 60/149 (40%)
Traf1NP_001258169.1 TRAF_BIRC3_bd 180..237 CDD:406958 6/56 (11%)
MATH_TRAF1 260..406 CDD:239748 60/149 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391991at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.