DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf4 and Rnf151

DIOPT Version :10

Sequence 1:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_080481.1 Gene:Rnf151 / 67504 MGIID:1914754 Length:239 Species:Mus musculus


Alignment Length:85 Identity:25/85 - (29%)
Similarity:39/85 - (45%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNK-CGAQIPRIMMTDHLQYTCTMRRTRCEF- 166
            |.|.:...||..:..|...|.|.::|..:...|||: |..|:.|.::.:|.|:.....:.||.. 
Mouse    81 VKCKNAAAGCLDTHPLAHRKEHQDSCPFELMACPNEGCTVQVLRGVLDEHRQHCQQNGQQRCPLG 145

  Fly   167 CQSEFSGAGLEEHNGSCGQE 186
            |.|..:....|.||  |.:|
Mouse   146 CGSTLAALEGEHHN--CYRE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 23/80 (29%)
zf-TRAF 233..292 CDD:280357
MATH_TRAF4 331..479 CDD:239750
Rnf151NP_080481.1 RING_Ubox 15..63 CDD:473075
Sina 79..>134 CDD:460824 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.