DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf4 and elgi

DIOPT Version :9

Sequence 1:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster


Alignment Length:241 Identity:47/241 - (19%)
Similarity:80/241 - (33%) Gaps:61/241 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PTPGNNNNNMPITELEQIIYPGPDPKHIMGSL----VFCIHHKQGCKWSDELRKLKGHLNACKHD 132
            ||...:.|::....|..:      |:.:...|    :.|.:...||....:|.....||:.|.|:
  Fly    51 PTCPVDRNSLTTANLRAV------PRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHN 109

  Fly   133 ATQ---CPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEHNGSCGQEPVYCEAKC 194
            ..:   |...||..||:..:.||   .|..........|:|..|   |..:....|:....|.| 
  Fly   110 PKRPFPCEKGCGFDIPKDELKDH---NCVRELRTLIVKQTEKMG---ELKSELTDQQLTINELK- 167

  Fly   195 GQRILRGRMTLHKSKDCAKRLRRCAHCQR----EFSADTLPLHAAQCPRA-------PLACPQRC 248
                    ..|...||..:.:|......|    :...|.:...::..|||       .::.|   
  Fly   168 --------RELQLFKDFMRAMRVSNPAMRAIADQMERDEVIRWSSTLPRARVTRWGGMISTP--- 221

  Fly   249 DAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLE 294
                           |:...|.:..:..|:||    |..:|::.:|
  Fly   222 ---------------DDALQLMIKRALSESGC----PPHILDSLME 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 22/99 (22%)
zf-TRAF 233..292 CDD:424248 11/65 (17%)
MATH_TRAF4 331..479 CDD:239750
elgiNP_001261904.1 RING 17..55 CDD:238093 2/3 (67%)
Sina 83..>157 CDD:302762 20/79 (25%)
USP8_interact 137..315 CDD:286082 25/146 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.