DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf4 and Rnf151

DIOPT Version :9

Sequence 1:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001100457.1 Gene:Rnf151 / 302977 RGDID:1309302 Length:238 Species:Rattus norvegicus


Alignment Length:143 Identity:40/143 - (27%)
Similarity:60/143 - (41%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNK-CGAQIPRIMMTDHLQYTCTMRRTRCEF- 166
            |.|.:...||..:..|...|||.::|..:...|||: |.||:.|.::.:|.|:.....:.||.. 
  Rat    81 VKCKNAAAGCLVTCPLAHRKGHQDSCPFELMACPNEGCTAQVLRGVLDEHRQHCQQNGQQRCPLG 145

  Fly   167 CQSEFSGAGLEEHNGSCGQEPVYCEAKCG--QRILRGRMTLHKSKDCAKRL--------RRCAHC 221
            |.:..:....|:||  |     |.|.:..  ||..|.|..|.......:|:        |:.|..
  Rat   146 CGATLAALEGEQHN--C-----YRELRDAWVQRHERNRTLLLNLLGRVRRVYRTTNLIRRQLAQL 203

  Fly   222 QREFSADTLPLHA 234
            ......|||.|:|
  Rat   204 SNFLEDDTLLLNA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 29/100 (29%)
zf-TRAF 233..292 CDD:424248 1/2 (50%)
MATH_TRAF4 331..479 CDD:239750
Rnf151NP_001100457.1 RING_Ubox 20..58 CDD:418438
Sina 83..>134 CDD:418524 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.