DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf4 and trf-2

DIOPT Version :9

Sequence 1:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_491534.2 Gene:trf-2 / 172151 WormBaseID:WBGene00022454 Length:335 Species:Caenorhabditis elegans


Alignment Length:293 Identity:70/293 - (23%)
Similarity:118/293 - (40%) Gaps:55/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PLHAAQCPRAPLACPQRCDAGPIPRG-------ELEAHLRDE----CQSLA----VSCSFKEAGC 280
            |:.:|..|..||..|....|...||.       .:..|:..|    .:|:.    :.|.|||.||
 Worm    29 PIKSASNPPTPLDSPFMAGAINRPRTSTRSVGVSIPIHVEGEEPTAPKSIVPDNWIDCPFKEHGC 93

  Fly   281 RFKGPRQMLEAHLESNAAAHLSLM--------VALSSRQG----------QQIQMLKSAVSKLSI 327
            ..||....::.|:..:...||.|:        ..::.:|.          |.:.:.:||..|...
 Worm    94 HKKGENSEVKRHVRDDRNLHLVLLCQSLNPIRTKINIQQSAYVDKYVGMLQYMSIAESAFEKYGS 158

  Fly   328 NYTGTLLWKITDWSAKMAEA-RGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIK 391
            .:|    ::|......:.:| :.|....:.|.|||:..||||:.|.....|:|.....:.||::.
 Worm   159 QHT----FRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVC 219

  Fly   392 VLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWEN----FQRPSNEPDQL---G 449
            ::.||:|.:|:|||...:||::....        .:..:....:.|    .|.....|:.|   .
 Worm   220 LMKGEWDDILEWPFRCDVTFSILSDD--------KKELLTKTIYVNEMPEIQEFLERPEGLRNGT 276

  Fly   450 FGFPRFISHELLHSRPFIKGDTVFLRVKVDPSK 482
            |||..|:  .|.....|.....:|:::||..||
 Worm   277 FGFQNFL--PLAKVTEFAADGDIFIQIKVLLSK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635
zf-TRAF 233..292 CDD:424248 19/73 (26%)
MATH_TRAF4 331..479 CDD:239750 37/155 (24%)
trf-2NP_491534.2 MATH_TRAF_C 158..304 CDD:238168 38/159 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I5900
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391991at33208
OrthoFinder 1 1.000 - - FOG0004698
OrthoInspector 1 1.000 - - otm14558
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3301
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.