DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf4 and RNF151

DIOPT Version :9

Sequence 1:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_005255186.1 Gene:RNF151 / 146310 HGNCID:23235 Length:254 Species:Homo sapiens


Alignment Length:215 Identity:53/215 - (24%)
Similarity:78/215 - (36%) Gaps:78/215 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNK-CGAQIPRIMMTDHLQYTCTMRRTRCEFC 167
            |.|.:...||..:..|...|||.::|..:.|.|||: |.:|:||..:.:|.|:           |
Human    90 VKCKNADAGCIVTCPLAHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQH-----------C 143

  Fly   168 QSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPL 232
            |.     |.::.          |...||..:           |.|:|.|.  :|.||       |
Human   144 QQ-----GSQQR----------CPLGCGATL-----------DPAERARH--NCYRE-------L 173

  Fly   233 HAA----QCPRAPLACPQRCDAGPIPRGELEAHLR-----DECQSLA------VSCSFKEAGCRF 282
            |.|    |..|.||               |.:.||     |:..|:.      :|...:|.....
Human   174 HNAWSVRQERRRPL---------------LLSLLRRVRWLDQATSVVRRELAELSNFLEEDTALL 223

  Fly   283 KG-PRQMLEAHLESNAAAHL 301
            :| |::..||..|.|..|.:
Human   224 EGAPQEEAEAAPEGNVGAEV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 23/97 (24%)
zf-TRAF 233..292 CDD:424248 16/74 (22%)
MATH_TRAF4 331..479 CDD:239750
RNF151XP_005255186.1 RING 29..70 CDD:238093
Sina 92..>139 CDD:302762 16/46 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.