DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf4 and RNF41

DIOPT Version :9

Sequence 1:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001229755.1 Gene:RNF41 / 10193 HGNCID:18401 Length:317 Species:Homo sapiens


Alignment Length:236 Identity:52/236 - (22%)
Similarity:77/236 - (32%) Gaps:88/236 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 CEFCQSEFSGAGLEEHNGSCGQEPVYCEAKCGQ------------------------RILRGRMT 204
            |..|    ||. |||...:...|..:|.|...|                        ||:|..: 
Human    18 CPIC----SGV-LEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPRIMRNML- 76

  Fly   205 LHKSK---DCAKRLRRCAHCQREFSADTLPLHAAQC---PRAPLACPQRCDAGPIPRGELE---- 259
               ||   .|...:..|:...|   .|.|..|.:.|   |:.|:.|.|.|.. .:|:.||.    
Human    77 ---SKLQIACDNAVFGCSAVVR---LDNLMSHLSDCEHNPKRPVTCEQGCGL-EMPKDELPNHNC 134

  Fly   260 -AHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQMLKSAVS 323
             .|||...|.                 :|...|.||..:|.|...:    :.|.:.||:||:.:.
Human   135 IKHLRSVVQQ-----------------QQTRIAELEKTSAEHKHQL----AEQKRDIQLLKAYMR 178

  Fly   324 KL------------SINYTGTLLW-------KITDWSAKMA 345
            .:            :|.|...|.|       ::|.|...::
Human   179 AIRSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMIS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 14/65 (22%)
zf-TRAF 233..292 CDD:424248 15/66 (23%)
MATH_TRAF4 331..479 CDD:239750 4/22 (18%)
RNF41NP_001229755.1 mRING-HC-C3HC3D_Nrdp1 15..57 CDD:319548 11/43 (26%)
USP8_interact 137..315 CDD:401040 21/104 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.