Sequence 1: | NP_477416.1 | Gene: | Traf4 / 33638 | FlyBaseID: | FBgn0026319 | Length: | 486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001229755.1 | Gene: | RNF41 / 10193 | HGNCID: | 18401 | Length: | 317 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 52/236 - (22%) |
---|---|---|---|
Similarity: | 77/236 - (32%) | Gaps: | 88/236 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 164 CEFCQSEFSGAGLEEHNGSCGQEPVYCEAKCGQ------------------------RILRGRMT 204
Fly 205 LHKSK---DCAKRLRRCAHCQREFSADTLPLHAAQC---PRAPLACPQRCDAGPIPRGELE---- 259
Fly 260 -AHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQMLKSAVS 323
Fly 324 KL------------SINYTGTLLW-------KITDWSAKMA 345 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Traf4 | NP_477416.1 | PLN03086 | <109..206 | CDD:178635 | 14/65 (22%) |
zf-TRAF | 233..292 | CDD:424248 | 15/66 (23%) | ||
MATH_TRAF4 | 331..479 | CDD:239750 | 4/22 (18%) | ||
RNF41 | NP_001229755.1 | mRING-HC-C3HC3D_Nrdp1 | 15..57 | CDD:319548 | 11/43 (26%) |
USP8_interact | 137..315 | CDD:401040 | 21/104 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D918518at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |