DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf4 and rnf151

DIOPT Version :9

Sequence 1:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_004918118.1 Gene:rnf151 / 101733072 XenbaseID:XB-GENE-6467161 Length:212 Species:Xenopus tropicalis


Alignment Length:136 Identity:37/136 - (27%)
Similarity:51/136 - (37%) Gaps:16/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNK-CGAQIPRIMMTDHLQYTCTMRRTRCEF- 166
            |.|.:.:.||.....|...:.|...|.:.|..|.|: |.|::.|..|.||: :.|...|..|.. 
 Frog    81 VKCPNEQNGCPAHFALVHSQEHAEYCAYGAVPCSNEGCPAEVLRKDMCDHI-HNCRYWRQHCHMG 144

  Fly   167 CQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRR-CAHCQREFSADTL 230
            |.:.......|.||  |.||.....||          .|:|.|..|.|:.. |....|:......
 Frog   145 CGTLLHPENRETHN--CYQELKEDYAK----------QLYKLKQKANRMETICCQISRQLQMMND 197

  Fly   231 PLHAAQ 236
            .:..||
 Frog   198 SMETAQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 26/98 (27%)
zf-TRAF 233..292 CDD:424248 2/4 (50%)
MATH_TRAF4 331..479 CDD:239750
rnf151XP_004918118.1 RING 20..61 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.